ITGA3 / CD49c Antibody (Cytoplasmic Domain, clone 29A3)
Product Sizes
100 ug
£ POA
LS-C24751-100UG
About this Product
- SKU:
- LS-C24751
- Additional Names:
- ITGA3, Alpha3 integrin, CD49c antigen, CD49C, GAPB3, Integrin alpha-3, FRP-2, VCA-2, VLA-3 subunit alpha, VL3A, VLA3a, Galactoprotein B3, GAP-B3, ILNEB, Integrin alpha3, MSK18
- Application:
- IHC-Frozen, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.2, 0.1% Sodium Azide, No stabilizing proteins added
- translate.label.attr.clone:
- 29A3
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- Synthetic peptide corresponding to the cytoplasmic domain of the integrin subunit a3A including an additional N-Terminus cysteine (CRTRALYEAKRQKAEMKSQPSETERLTDDY) coupled to keyhole limpet hemocyanin.
- Isotype:
- IgG1
- Purification:
- Protein G Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Recognizes specifically the cytoplasmic domain of human integrin subunit a3A which is present in the basal cell layer in skin, glomeruli, Bowman's capsules and distal tubuli in kidney, all vascular and capillary endothelia in brain, heart and skin, and vascular smooth muscle cells in heart. A broad species reactivity is expected because of the conserved nature of the epitope.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:25333
