AMH / Anti-Mullerian Hormone Antibody (clone 5/6, Supernatant)
Product Sizes
1 ml
£ POA
LS-C188251-1ML
About this Product
- SKU:
- LS-C188251
- Additional Names:
- AMH, Anti-Muellerian hormone, Anti-Mullerian hormone, Muellerian-inhibiting factor, Mullerian inhibiting factor, Mullerian inhibiting substance, MIS
- Application:
- IHC-Paraffin, Immunohistochemistry
- Buffer:
- 0.1% Sodium Azide
- translate.label.attr.clone:
- 5/6
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- Synthetic peptide derived from human AMH (VPTAYAGKLLISLSEERISAHHVPNMVATEC). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Monkey, Galago, Marmoset, Mouse, Pig (100%); Panda, Dog, Bovine (97%); Rat, Guinea pig (94%).
- Isotype:
- IgG1
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Is expressed post-natally by immature Sertoli cells, and to a lesser degree by granulosa cells. Plays a role in testicular differentiation and in the regulation of ovarian follicle growth. Is a member of the TGF beta superfamily. It is secreted as a homodimeric 140kD disulphide linked precursor that is cleaved to release the mature 30kD homodimer.
- Storage Conditions:
- 2[o]C to 8[o]C or -20[o]C Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:196154
