IL21 Antibody (aa40-68)
Product Sizes
50 ug
£ POA
LS-C187848-50UG
About this Product
- SKU:
- LS-C187848
- Additional Names:
- IL21, Interleukin 21, Interleukin-21, Interleukin-21 isoform, Za11, IL-21
- Application:
- ELISA, IHC-Paraffin, Immunohistochemistry
- Buffer:
- PBS, 0.1% Sodium Azide, 0.1% BSA
- Clonality:
- Polyclonal
- Host:
- Goat
- Immunogen:
- Synthetic peptide C-RQLIDIVDQLKNYVNDLVPEFLPAPEDVE corresponding to amino acids 40-68 within the N-Terminus of human IL-21. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan (100%); Gibbon, Monkey, Marmoset (97%); Sheep, Bovine, Horse (93%); Elephant, Dog (90%); Panda, Cat, Pig (83%).
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Recognizes human interleukin-21, also known as IL-21 or Za11. IL-21 is a, a 155 amino acid pro-cytokine, reduced to 133 amino acids in the secreted mature form. IL-21 is a potent immunoregulatory cytokine and member of the IL-15/IL-21 family, expressed and secreted by activated CD4+ T cells. Two potential isoforms are generated by alternative splicing and differing is sequence at the C-terminus. R
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles. Store undiluted.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:195751
