HMOX1 / HO-1 Antibody (aa1-30)
Product Sizes
200 ug
£ POA
LS-C15741-200UG
50 ug
£ POA
LS-C15741-50UG
About this Product
- SKU:
- LS-C15741
- Additional Names:
- HMOX1, BK286B10, HO-1, HSP32, Heat shock protein, 32-kD, Heme oxygenase (decycling) 1, Heme oxygenase 1, HO1
- Application:
- Immunoprecipitation, Western Blot
- Buffer:
- PBS, 0.09% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to aa1-30 of human HO-1 prepared as a four branched multiple antigen peptide. Percent identity by BLAST analysis: Human, Orangutan, Gibbon, Marmoset, Bat (100%); Monkey, Mouse (97%); Elephant (90%); Rat, Pig (87%).
- Isotype:
- IgG
- Reactivities:
- Human, Other Mammal
- Shipping Conditions:
- Ambient
- Specificity:
- Identifies purified rat HO-1 protein and will detect an ~32kD protein, corresponding to the apparent molecular mass of heme-oxygenase-1 on SDS-PAGE immunoblot. Species cross-reactivity: human, mouse, rat, canine, monkey, rabbit and hamster. Does not detect heme-oxygenase-2.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:16482
