PTH / Parathyroid Hormone Antibody (aa1-38, clone A1/70)
Product Sizes
10 ug
£ POA
LS-C122285-10UG
100 ug
£ POA
LS-C122285-100UG
About this Product
- SKU:
- LS-C122285
- Additional Names:
- PTH, Parathyroid hormone, Parathyroid hormone 1, Parathyrin, Parathormone, PTH1
- Application:
- IHC-Frozen, IHC-Paraffin, Immunohistochemistry, Radioimmunoassay
- Buffer:
- Lyophilized PBS, pH 7.2
- translate.label.attr.clone:
- A1/70
- Clonality:
- Monoclonal
- Host:
- Mouse
- Immunogen:
- Synthetic human PTH (aa 1-38) polylysine conjugated(SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG). Percent identity by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Horse (97%); Elephant, Panda, Dog, Pig (94%); Bovine (90%); Hamster, Cat (87%); Rat (84%); Mouse (81%).
- Isotype:
- IgG1
- Physical State:
- Lyophilized
- Purification:
- Protein A Purified
- Reactivities:
- Human, Non-human Primate
- Shipping Conditions:
- Ambient
- Specificity:
- Recognizes Human PTH peptide (aa 15-25; 1-34; 1-38; 1-84; 7-84). There were no cross reactivities obtained with synthetic human PTH (aa 1-3; 1-10; 4-16; 28-48; 39-84; 44-68; 53-84) and PTHrP (aa 1-86).
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C lyophilized.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- Manufacturer's Data Sheet:125743
