STAT3 Antibody (aa688-722)
Product Sizes
200 ug
£ POA
LS-C10382-200UG
About this Product
- SKU:
- LS-C10382
- Additional Names:
- STAT3, Acute-phase response factor, APRF, DNA-binding protein APRF, HIES
- Application:
- Gel Shift/EMSA, Immunocytochemistry, Immunoprecipitation, Western Blot
- Buffer:
- 0.1 M Tris-glycine, pH 7.4, 0.15 M sodium chloride, 0.05% sodium azide, 40% glycerol.
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Bacterially expressed GST fusion protein corresponding to human STAT3 (aa 688-722, RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B. Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Bovine, Horse, Pig, Opossum (100%); Sheep (97%); Chicken (84%).
- Isotype:
- IgG
- Purification:
- Protein A Purified
- Reactivities:
- Bovine, Hamster, Horse, Human, Mouse, Non-human Primate, Porcine, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Recognizes STAT3 (92kD). A second unknown band at 50kD may be observed with longer exposures or at high concentrations of the antibody. Species cross-reactivity: Human, rat and mouse.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles., 2-8[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:11123
