IHC-plus[TM] Vasohibin 1 / VASH1 Antibody (clone 4A3)
Product Sizes
50 ug
LS-B9426-50UG
About this Product
- SKU:
- LS-B9426
- Additional Names:
- VASH1, KIAA1036, VASH, Vasohibin 1, Vasohibin-1
- Application:
- ELISA, IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.4
- translate.label.attr.clone:
- 4A3
- Clonality:
- Monoclonal
- Concentration:
- 1 mg/ml
- Host:
- Mouse
- Immunogen:
- VASH1 (NP_055724, 3 aa ~ 100 aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
- Isotype:
- IgG2a, kappa
- Purification:
- Protein A Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human VASH1 Sequence: GGKKVAGGGSSGATPTSAAATAPSGVRRLETSEGTSAQRDEEPEEEGEEDLRDGGVPFFVNRGGLPVDEATWERMWKHVAKIHPDGEKVAQRIRGATD
- Storage Conditions:
- -20[o]C/-70[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Monoclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:209020
