NFKB1 / NF-Kappa-B Antibody (N-Terminus)
Product Sizes
50 ul
LS-B8072-50UL
About this Product
- SKU:
- LS-B8072
- Additional Names:
- NFKB1, Ebp- 1, EBP-1, NF-KappaB p50, NFkappaB, NFKB-p50, KBF1, NF-kappa-B, NF-kappaB, NF-kB1, NFKB-p105, p105, p50, DNA binding factor KBF1, DNA-binding factor KBF1, NF-kappabeta
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, 0.09% sodium azide, 2% sucrose
- Clonality:
- Polyclonal
- Concentration:
- 0.5 mg/ml
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide from N-Terminus of human NFKB1 (P19838, NP_003989, aa 11-60) within the region PEQMFHLDPSLTHTIFNPEVFQPQMALPTDGPYLQILEQPKQRGFRFRYV. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Monkey, Galago, Marmoset, Mouse, Rat, Elephant, Dog, Bovine, Bat, Horse, Pig, Opossum, Guinea pig (100%); Rabbit, Turkey, Zebra finch, Chicken (92%); Stickleback, Zebrafish (85%); Salmon (84%).
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Avian, Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human NFKB1
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:161844
