IHC-plus[TM] AIFM1 / AIF / PDCD8 Antibody
Product Sizes
100 ul
£501.00
LS-B7901-100UL
About this Product
- SKU:
- LS-B7901
- Additional Names:
- AIFM1, AIF, COXPD6, PDCD8, Programmed cell death 8
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- TBS, 0.5 mg/ml BSA, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Human AIF amino acids 151-180 (RARDPGARVLIVSEDPELPYMRPPLSKELW) conjugated to BSA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:159788
