IHC-plus[TM] PTGER4 / EP4 Antibody
Product Sizes
1 each
LS-B6947-1EACH
About this Product
- SKU:
- LS-B6947
- Additional Names:
- PTGER4, EP4, EP4 prostaglandin receptor, EP4R, PGE receptor EP4 subtype, Prostanoid EP4 receptor, Prostaglandin E receptor 4, PGE receptor, EP4 subtype, PGE2 receptor EP4 subtype
- Application:
- IHC-Paraffin, Immunocytochemistry, Immunohistochemistry, Western Blot
- Buffer:
- TBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, 0.1% BSA
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Human EP4 receptor C-Terminus amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Monkey (100%); Gibbon, Bovine (97%); Rabbit (93%); Marmoset (90%); Bat, Hamster, Elephant, Panda (87%); Horse (83%); Mouse, Rat (80%).
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Does not cross-react with EP1, EP3, or EP4 receptors. The EP2 receptor appears to be expressed at low levels in many tissues and cell types, potentially making detection by immunochemical techniques difficult.
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:155192
