AATF Antibody (aa171-220)
Product Sizes
50 ul
£501.00
LS-B17062-50UL
About this Product
- SKU:
- LS-B17062
- Additional Names:
- AATF, CHE1, DED, Rb-binding protein Che-1, CHE-1, Protein AATF
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, 0.09% sodium azide, 2% sucrose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Synthetic peptide located between aa171-220 of human AATF (Q9NY61, NP_036270) within the region EEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEE. Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Gibbon, Rabbit (100%); Monkey, Elephant (92%); Marmoset (91%); Galago (85%); Bat, Horse (84%).
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human AATF
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles., 2-8[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:857485
