PathPlus[TM] GLS / Glutaminase Antibody
Product Sizes
50 ul
LS-B16566-50UL
About this Product
- SKU:
- LS-B16566
- Additional Names:
- GLS, AAD20, GLS1, GAM, Glutaminase C, GAC, K-glutaminase, KIAA0838, L-glutamine amidohydrolase, Glutaminase, KGA
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 610-669 of human GLS (NP_055720.3). KVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human GLS / Glutaminase
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:848063
