IHC-plus[TM] L1CAM Antibody
Product Sizes
100 ug
LS-B16564-100UG
About this Product
- SKU:
- LS-B16564
- Additional Names:
- L1CAM, CAML1, CD171 antigen, HSAS, HSAS1, MASA, MIC5, N-CAM-L1, N-CAML1, L1 cell adhesion molecule, NCAM-L1, S10, SPG1, CD171
- Application:
- IHC-Paraffin
- Buffer:
- Lyophilized from 0.2mg Na2HPO4, 0.9mg NaCl, 0.05mg sodium azide, 4mg Trehalose
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence of human L1CAM (NMVITWKPLRWMDWNAPQVQYRVQWRPQGTRGPW).
- Physical State:
- Lyophilized
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Aliquot. Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:848061
