IHC-plus[TM] PGIS / PTGIS Antibody (aa299-329)
Product Sizes
1 each
LS-B1615-1EACH
About this Product
- SKU:
- LS-B1615
- Additional Names:
- PTGIS, CYP8A1, Prostaglandin I2 synthase, Prostacyclin synthase, PTGI, CYP8, PGIS
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- TBS, pH 7.4, 0.02% Sodium Azide, 50% Glycerol, 0.5% BSA
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Bovine PGIS amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT). Percent identity by BLAST analysis: Bovine (100%); Horse, Pig (87%); Gibbon, Monkey, Bat (83%); Human (80%).
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Bovine, Human
- Shipping Conditions:
- Ambient
- Specificity:
- Bovine amino acids 299-329 (LLKNPEALAAVRGELETVLLGAEQPISQMTT)1,2,3
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:47121
