IHC-plus[TM] SCA2 / LY6E Antibody
Product Sizes
50 ul
LS-B15888-50UL
About this Product
- SKU:
- LS-B15888
- Additional Names:
- LY6E, 9804, Lymphocyte antigen 6E, RIG-E, RIGE, SCA2, SCA-2, Ly-6E, TSA-1, TSA1, Retinoic acid induced gene E, Stem cell antigen 2, Thymic shared antigen 1
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 1.312 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 21-101 of human LY6E (NP_002337.1). LMCFSCLNQKSNLYCLKPTICSDQDNYCVTVSASAGIGNLVTFGHSLSKTCSPACPIPEGVNVGVASMGISCCQSFLCNFS
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:776661
