IHC-plus[TM] CARTPT / CART Antibody
Product Sizes
50 ul
LS-B15879-50UL
About this Product
- SKU:
- LS-B15879
- Additional Names:
- CARTPT, CART, CART prepropeptide, Hcart
- Application:
- IHC-Paraffin, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 28-116 of human CARTPT (NP_004282.1). QEDAELQPRALDIYSAVDDASHEKELIEALQEVLKKLKSKRVPIYEKKYGQVPMCDAGEQCAVRKGARIGKLCDCPRGTSCNSFLLKCL
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human CARTPT / CART
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:776652
