IHC-plus[TM] CYBA / p22phox Antibody
Product Sizes
50 ul
LS-B15780-50UL
About this Product
- SKU:
- LS-B15780
- Additional Names:
- CYBA, Cytochrome b(558) alpha chain, Cytochrome b-245 light chain, Cytochrome b558 subunit alpha, p22 phagocyte B-cytochrome, p22-PHOX, Cytochrome b light chain, p22phox
- Application:
- IHC-Paraffin, Immunofluorescence
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 126-195 of human CYBA (NP_000092.2). VRGEQWTPIEPKPRERPQIGGTIKQPPSNPPPRPPAEARKKPSEEEAAVAAGGPPGGPQVNPIPVTDEVV
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Storage Conditions:
- Please refer to datasheet
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:769107
