IHC-plus[TM] MARCO Antibody
Product Sizes
50 ul
LS-B15577-50UL
About this Product
- SKU:
- LS-B15577
- Additional Names:
- MARCO, Macrophage receptor MARCO, Macrophage receptors marco, SCARA2
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS with 0.05% proclin300, 50% glycerol, pH7.3
- Clonality:
- Polyclonal
- Concentration:
- 2.29 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 421-520 of human MARCO (NP_006761.1). SVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:697210
