PathPlus[TM] CD36 Antibody
Product Sizes
50 ul
LS-B15329-50UL
About this Product
- SKU:
- LS-B15329
- Additional Names:
- CD36, Cluster determinant 36, FAT, Fatty acid translocase, Glycoprotein IIIb, gp4, GPIIIB, GPIV, PAS-4 protein, PAS IV, PASIV, Platelet collagen receptor, Platelet glycoprotein IV, SCARB3, Thrombospondin receptor, BDPLT10, CD36 antigen, CHDS7, gp3B, PAS-4, Platelet glycoprotein 4
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 301-400 of human CD36 (NP_001120916.1). ASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQ
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human CD36
- Storage Conditions:
- -70[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:689799
