PathPlus[TM] TFF3 / Trefoil Factor 3 Antibody
Product Sizes
100 ul
LS-B14380-100UL
About this Product
- SKU:
- LS-B14380
- Additional Names:
- TFF3, HP1.B, Intestinal trefoil factor, HITF, ITF, TFI, p1B, Polypeptide P1.B, Trefoil factor 3, Trefoil factor 3 (intestinal)
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Concentration:
- 3.66 mg/ml
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 22-94 of human TFF3 (NP_003217.3). MLGLVLALLSSSSAEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDSRIPGVPWCFKPLQEAECTF
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse
- Shipping Conditions:
- Ambient
- Specificity:
- Human TFF3 / Trefoil Factor 3.
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:504299
