IHC-plus[TM] CXCL7 / PPBP Antibody
Product Sizes
50 ul
LS-B14379-50UL
About this Product
- SKU:
- LS-B14379
- Additional Names:
- PPBP, Beta-thromboglobulin, B-TG1, Beta-TG, C-X-C motif chemokine 7, CTAP3, CXCL7, CTAP-III, CXC chemokine ligand 7, NAP-2, NAP-2-L1, PBP, LA-PF4, LDGF, SCYB7, Small-inducible cytokine B7, Small inducible cytokine B7, THBGB1, Thrombocidin 2, TC2, TGB, Thrombocidin 1, Thromboglobulin, beta-1, CTAPIII, MDGF, Platelet basic protein, SCAR10, TC1, THBGB
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 31-128 of human PPBP (NP_002695.1). TALASSTKGQTKRNLAKGKEESLDSDLYAELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human
- Shipping Conditions:
- Ambient
- Specificity:
- Human CXCL7 / PPBP
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:504298
