IHC-plus[TM] TGFA / TGF Alpha Antibody
Product Sizes
50 ul
LS-B14370-50UL
About this Product
- SKU:
- LS-B14370
- Additional Names:
- TGFA, Etgf, TFGA, TGF Alpha, Tgf type 1, TGF-alpha, Egf-like tgf
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- Recombinant fusion protein containing a sequence corresponding to amino acids 24-98 of human TGFA (NP_001093161.1). ENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQA
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human TGFA / TGF Alpha
- Storage Conditions:
- -20[o]C Avoid freeze/thaw cycles.
- Type:
- Antibody: Polyclonal Antibody
- Manufacturer's Data Sheet:504289
