IHC-plus[TM] TSG101 Antibody
Product Sizes
50 ul
LS-B13375-50UL
About this Product
- SKU:
- LS-B13375
- Additional Names:
- TSG101, ESCRT-I complex subunit TSG101, Tumor susceptibility gene 10, Tumor susceptibility protein, VPS23, Tumor susceptibility gene 101, TSG10
- Application:
- IHC-Paraffin, Immunohistochemistry, Western Blot
- Buffer:
- PBS, pH 7.3, 0.02% Sodium Azide, 50% Glycerol
- Clonality:
- Polyclonal
- Host:
- Rabbit
- Immunogen:
- A synthetic peptide corresponding to a sequence within amino acids 300 to the C-Terminus of human TSG101 (NP_006283.1). SALEKMENQSENNDIDEVIIPTAPLYKQILNLYAEENAIEDTIFYLGEALRRGVIDLDVFLKHVRLLSRKQFQLRALMQKARKTAGLSDLY
- Isotype:
- IgG
- Purification:
- Affinity Purified
- Reactivities:
- Human, Mouse, Rat
- Shipping Conditions:
- Ambient
- Specificity:
- Human TSG101
- Storage Conditions:
- -70[o]C Avoid freeze/thaw cycles.
- Supplier:
- LifeSpan Biosciences
- Type:
- Antibody: Polyclonal Antibody
- 2B Price Match:
Click the image to find out more! Ask, or in our "About Us" Section!- 2BScientific on Trustpilot:
- Free UK Delivery:
- Standard UK Delivery is free for orders over £100
- Manufacturer's Data Sheet:400073
