Bay 55-9837
About this Product
- SKU:
- VP-020
- Additional Names:
- Bay 55-9837, 463930-25-8, HSDAVFTDNYTRLRKQVAAKKYLQSIKNKRY-NH2, VP-020
- CAS Number:
- 463930-25-8
- Extra Details:
- Bay 55-9837 is a selective vasoactive intestinal peptide receptor 2 (VPAC2 receptor) agonist, binding to VPAC2 with a Kd of 0.65 nmol/l and having greater than 100-fold selectivity over VPAC1. BAY 55-9837 stimulates glucose-dependent insulin secretion in isolated pancreatic islets, increases insulin synthesis in rat islets, and causes a dose-dependent increase in plasma insulin levels in fasted rats. BAY 55-9837 raises survival motor neuron (SMN) protein levels through pharmacological modulation of the SMN2 gene and ameliorates disease phenotype in severe spinal muscular atrophy mouse models
- Immunogen:
- Vasoactive intestinal peptide (VIP) receptors
- Molecular Weight:
- 3742.29
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Tsutsumi et al (2002) A potent and highly selective VPAC2 agonist enhances glucose-induced Ins release and glucose disposal: a potential therapy for type 2 diabetes. Diabetes<strong> 51</strong> 1453 <a href="https://pubmed.ncbi.nlm.nih.gov/11978642/" target="_blank" rel="nofollow">PMID: 11978642</a></p><p>Darsalia et al (2013)The specific VPAC2 agonist Bay 55-9837 increases neuronal damage and hemorrhagic transformation after stroke in type 2 diabetic rats. Neuropeptides <strong>47</strong>(2) 133 <a href="https://pubmed.ncbi.nlm.nih.gov/22981158/" target="_blank" rel="nofollow">PMID: 22981158</a></p><p>Hadwen et al (2014) VPAC2 receptor agonist BAY 55-9837 increases SMN protein levels and moderates disease phenotype in severe spinal muscular atrophy mouse models. Orphanet J Rare Dis. <strong>9 </strong>4 <a href="https://pubmed.ncbi.nlm.nih.gov/24405637/" target="_blank">PMID: 24405637</a><br></p>
- Sequence:
- H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Val-Ala-Ala-Lys-Lys-Tyr-Leu-Gln-Ser-Ile-Lys-Asn-Lys-Arg-Tyr-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 2 mg/ml in water
- Formula:
- C167H270N52O46
