VIP
About this Product
- SKU:
- VP-010
- Additional Names:
- VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil|VIP (human, rat, mouse, rabbit, canine, porcine), Vasoactive intestinal peptide, Aviptadil, 40077-57-4, HSDAVFTDNYTRLRKQMAVKKYLNSILN-NH2, HSDAVFTDNYTRLRKQMAVKKYLNSILN
- CAS Number:
- 40077-57-4
- Extra Details:
- VIP (Vasoactive intestinal peptide) is a 28 amino acid peptide originally isolated from swine intestines and found to be vasoactive by dilating arterioles. VIP is widely distributed in both the central and peripheral nervous system and is released by both neurons and immune cells. VIP has pleiotropic effects as a neurotransmitter, immune regulator, vasodilator and secretagogue. VIP is a master circadian regulator, as its deletion in mice causes a cycling shift in wake/sleep duration with reduced food intake and body weight.
- Immunogen:
- Vasoactive intestinal peptide (VIP) receptors
- Molecular Weight:
- 3325.8
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Laburthe and Couvineau (2002) Molecular pharmacology and structure of VPAC Receptors for VIP and PACAP. Regul Pept. <strong>08</strong>(2-3):165 doi: 10.1016/s0167-0115(02)00099-x. PMID: 12220741</p><p>Delgado and Ganea (2013) Vasoactive intestinal peptide: a neuropeptide with pleiotropic immune functions. Amino Acids. <strong>45</strong>(1) 25 doi:10.1007/s00726-011-1184-8<br></p><p>Bains (2019) Vasoactive Intestinal Peptide Deficiency Is Associated With Altered Gut Microbiota Communities in Male and Female C57BL/6 Mice. Front. Microbiology <strong>10</strong> 2689 https://www.frontiersin.org/article/10.3389/fmicb.2019.02689 </p>
- Sequence:
- H-His-Ser-Asp-Ala-Val-Phe-Thr-Asp-Asn-Tyr-Thr-Arg-Leu-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Asn-Ser-Ile-Leu-Asn-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 1 mg/ml in water
- Formula:
- C147H238N44O42S
