KP1
About this Product
- SKU:
- PP-290
- Additional Names:
- KP1 (human), Klotho-derived peptide 1|KP1, FQGTFPDGFLWAVGSAAYQTEGGWQQHGKG, PP-290, PP290, KP-1
- Extra Details:
- KP1 is a peptide representing the sequence Phe57 to Lys86 of the anti aging protein Klotho, and is one of the buried B Beta-strands in the N-terminal domain. KP1 mimics the anti-fibrotic action of Klotho by constraining TGF-B Beta signaling, KP1 acts through binding to TGF-B Beta receptor 2 (TB BetaR2) and disrupting TGF-B Beta/TB BetaR2 interaction. KP1 inhibits multiple downstream TGF-B Beta pathways including activation of Smad2/3 and mitogen activated protein kinases. In mouse models of renal fibrosis, KP1 preserves kidney function, ameliorates renal fibrosis and restores endogenous Klotho expression.
- Immunogen:
- Protein-protein interactions
- Molecular Weight:
- 3228.48
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Yuan (2022) A Klotho-derived peptide protects against kidney fibrosis by targeting TGF-β signaling. Nat Commun. <strong>13</strong>(1) 438 <a href="https://pubmed.ncbi.nlm.nih.gov/35064106/" target="_blank" rel="nofollow">PMID: 35064106</a>
- Sequence:
- H-Phe-Gln-Gly-Thr-Phe-Pro-Asp-Gly-Phe-Leu-Trp-Ala-Val-Gly-Ser-Ala-Ala-Tyr-Gln-Thr-Glu-Gly-Gly-Trp-Gln-Gln-His-Gly-Lys-Gly-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C149H203N39O43
