Tat-beclin 1
About this Product
- SKU:
- PP-200
- Additional Names:
- Tat-Beclin 1, 1423821-88-8, PP-200, YGRKKRRQRRRGGTNVFNATFEIWHDGEFGT, Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide|Tat-BECN1, Beclin-1 Activator I, beclin 1 peptide
- CAS Number:
- 1423821-88-8
- Extra Details:
- Tat-beclin 1 is a cell permeable peptide derived from the domain of the autophagy protein beclin 1 that interacts with HIV-1 Nef, attached to the HIV-1 Tat protein transduction domain. Tat-beclin 1 activates beclin1 by competing against its negative regulator GAPR-1/glioma pathogenesis-related protein-2 (GLIPR2). Tat-beclin 1 suppresses the accumulation of htt103Q, a polyglutamine expansion protein derived from human mutant Huntingtin protein, and can inhibit the replication of pathogens including HIV-1 and West Nile virus in vitro and in vivo.
- Immunogen:
- Protein-protein interactions,Antivirals
- Molecular Weight:
- 3741.15
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Shoji-Kawata et al (2013) Identification of a candidate therapeutic autophagy-inducing peptide. Nature <strong>494</strong>(7436) 201 <a href="https://pubmed.ncbi.nlm.nih.gov/23364696/" target="_blank" rel="nofollow">PMID: 23364696</a></p><p>Maejima (2016) Regulation of autophagy by Beclin 1 in the heart. J Mol Cell Cardiol <strong>95</strong> 19 <a href="https://pubmed.ncbi.nlm.nih.gov/26546165/" target="_blank" rel="nofollow">PMID: 26546165</a></p><p>Wong (2019) Intestinal epithelial tight junction barrier regulation by autophagy-related protein ATG6/beclin 1. Am J Physiol Cell Physiol. <strong>316</strong>(5) C753 <a href="https://pubmed.ncbi.nlm.nih.gov/30892937/" target="_blank" rel="nofollow">PMID: 30892937</a></p>
- Sequence:
- H-Tyr-Gly-Arg-Lys-Lys-Arg-Arg-Gln-Arg-Arg-Arg-Gly-Gly-Thr-Asn-Val-Phe-Asn-Ala-Thr-Phe-Glu-Ile-Trp-His-Asp-Gly-Glu-Phe-Gly-Thr-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C164H251N57O45
