WaTx
About this Product
- SKU:
- PN-120
- Additional Names:
- Wasabi receptor toxin|WaTx, WaTx, wasabi receptor toxin, venom, black rock scorpion Urodacus manicous, transient receptor potential cation channel 1, TRPA1, pain , H-ASPQQAKYC*YEQC*NVNKVPFDQC*YQMC*SPLERS-OH (disulphide bridge between C 9 and C 27 and C 13 and C23, ASPQQAKYCYEQCNVNKVPFDQCYQMCSPLERS, PN-120, PN120
- Extra Details:
- WaTx, also known as wasabi receptor toxin, is the active component of the venom of the Australian black rock scorpion Urodacus manicatus. WaTx targets the mechanical and chemical stress sensor transient receptor potential cation channel 1 (TRPA1), which it stabilizes in an active state characterized by prolonged channel openings and low Ca2+ permeability. WaTx elicits acute pain and pain hypersensitivity, but fails to trigger efferent release of neuropeptides and neurogenic inflammation typically produced by other toxins. WaTx is a unique pharmacological probe for dissecting TRPA1 function and its contribution to acute and persistent pain.
- Immunogen:
- Transient receptor potential (TRP) channels
- Molecular Weight:
- 3855.3
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Lin King et al (2019) A Cell-Penetrating Scorpion Toxin Enables Mode-Specific Modulation of TRPA1 and Pain Cell <strong>178</strong>(6) 1362 doi:10.1016/j.cell.2019.07.014
- Sequence:
- H-Ala-Ser-Pro-Gln-Gln-Ala-Lys-Tyr-Cys-Tyr-Glu-Gln-Cys-Asn-Val-Asn-Lys-Val-Pro-Phe-Asp-Gln-Cys-Tyr-Gln-Met-Cys-Ser-Pro-Leu-Glu-Arg-Ser-OH (disulphide bridge between C9 and C27 and C13 and C23)
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Storage desiccated, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in DMSO as stock.
- Formula:
- C164H245N45O53S5
