Parathyroid hormone (1-34) (rat)
About this Product
- SKU:
- PH-040
- Additional Names:
- Parathyroid hormone (1-34) (rat), PT-040, PT040, PT 040, 98614-76-7, AVSEIQLMHNLGKHLASVERMQWLRKKLQDVHNF, PH-040|pTH (1-34) (rat)
- CAS Number:
- 98614-76-7
- Extra Details:
- Parathyroid hormone (1-34) (rat) is a parathyroid hormone receptor agonist, which can increase serum parathyroid hormone levels and bone mass in rats. Parathyroid hormone (1-34) (rat) treatment significantly improved weight bearing and treadmill endurance, preserved GAG and collagen type II, and reduced the OARSI score and terminal differentiation markers in rat models of osteoarthritis. Parathyroid hormone (1-34) (rat) alleviates disease progression in a papain induced osteoarthritis in vivo rat model.
- Immunogen:
- Parathyroid hormone receptors
- Molecular Weight:
- 4057.74
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Yu and Chandrasekhar (1997) Parathyroid hormone (PTH 1-34) regulation of rat osteocalcin gene transcription. Endocrinology <strong>138</strong>(8) 3085 <a href="https://pubmed.ncbi.nlm.nih.gov/9231754/" target="_blank" rel="nofollow">PMID: 9231754</a></p><p>Chang et al (2009) Parathyroid hormone 1-34 inhibits terminal differentiation of human articular chondrocytes and osteoarthritis progression in rats. Arthritis Rheum. <strong>60</strong>(10) 3049 <a href="https://pubmed.ncbi.nlm.nih.gov/19790062/" target="_blank" rel="nofollow">PMID: 19790062</a></p><p>Chen et al (2018) Parathyroid hormone-(1-34) ameliorated knee osteoarthritis in rats via autophagy. J Appl Physiol (1985) <strong>124</strong>(5) 1177 <a href="https://pubmed.ncbi.nlm.nih.gov/29357491/" target="_blank" rel="nofollow">PMID: 29357491</a></p>
- Sequence:
- H-Ala-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Ala-Ser-Val-Glu-Arg-Met-Gln-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 1 mg/ml in water
- Formula:
- C180H291N55O48S2
