TIP 39
About this Product
- SKU:
- PH-020
- Additional Names:
- SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP, TIP 39, TIP39, Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues, PH-020|Tuberoinfundibular neuropeptide, Tuberoinfundibular peptide of 39 residues
- Extra Details:
- TIP 39, or Tuberoinfundibular peptide of 39 residues, is a peptide that was first identified from bovine hypothalamus, which in humans is encoded by the PTH2 gene. TIP39 is related to parathyroid hormone and PTH-related protein and is a potent and selective agonist at parathyroid hormone 2 (PTH2) receptors. PTH2 receptors are highly expressed in the nervous system, and have roles in the modulation of pituitary function and in nociception.
- Immunogen:
- Parathyroid hormone receptors
- Molecular Weight:
- 4504.24
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Usdin et al (1999) TIP39: a new neuropeptide and PTH2-receptor agonist from hypothalamus. Nat. Neurosci <strong>2</strong> 941 https://doi.org/10.1038/14724</p><p>Della Penna et al (2003) Tuberoinfundibular peptide of 39 residues (TIP39): molecular structure and activity for parathyroid hormone 2 receptor, Neuropharmacology <strong>44</strong>(1) 141 https://doi.org/10.1016/S0028-3908(02)00335-0</p><p>Weaver et al (2017) High affinity binding of the peptide agonist TIP-39 to the parathyroid hormone 2 (PTH2) receptor requires the hydroxyl group of Tyr-318 on transmembrane helix 5, Biochemical Pharmacology <strong>127 </strong>71 https://doi.org/10.1016/j.bcp.2016.12.013</p>
- Sequence:
- H-Ser-Leu-Ala-Leu-Ala-Asp-Asp-Ala-Ala-Phe-Arg-Glu-Arg-Ala-Arg-Leu-Leu-Ala-Ala-Leu-Glu-Arg-Arg-His-Trp-Leu-Asn-Ser-Tyr-Met-His-Lys-Leu-Leu-Val-Leu-Asp-Ala-Pro-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C202H325N61O54S
