Parathyroid hormone (1-34) (human)
About this Product
- SKU:
- PH-010
- Additional Names:
- PTH 1-34, hPTH (1-34), Teriparatide, Human parathyroid hormone (1-34)|PTH 1-34, hPTH (1-34), Teriparatide, Parathyroid hormone (1-34) (human), 52232-67-4, SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF, Human parathyroid hormone (1-34), PH-010
- CAS Number:
- 52232-67-4
- Extra Details:
- Parathyroid hormone (1-34) (human), also known as teriparatide or (PTH 1-34) is the N-terminal fragment of the intact hormone human parathyroid hormone (PTH), an 84-amino acid polypeptide secreted from the parathyroid gland. Intermittently administered parathyroid hormone (PTH 1-34) has been shown to promote bone formation in both human and animal studies. Parathyroid and its analogues stimulate both bone formation and resorption, and at low doses are in clinical use for the treatment of severe osteoporosis.
- Immunogen:
- Parathyroid hormone receptors
- Molecular Weight:
- 4117.77
- Physical State:
- Freeze fried solid
- Purity:
- >95%
- References:
- <p>Dobnig and Turner (1997) The effects of programmed administration of human parathyroid hormone fragment (1-34) on bone histomorphometry and serum chemistry in rats. Endocrinology <strong>138</strong> 4607 PMID: 9348185 </p><p>Manabe et al (2007) Human parathyroid hormone (1-34) accelerates natural fracture healing process in the femoral osteotomy model of cynomolgus monkeys. Bone 40 1475 PMID: 17369013</p><p>Osagie-Clouard et al (2017) Parathyroid hormone 1-34 and skeletal anabolic action: The use of parathyroid hormone in bone formation. Bone Joint Res. 6(1) 14 doi:10.1302/2046-3758.61.BJR-2016-0085.R1 </p><p><br></p>
- Sequence:
- H-Ser-Val-Ser-Glu-Ile-Gln-Leu-Met-His-Asn-Leu-Gly-Lys-His-Leu-Asn-Ser-Met-Glu-Arg-Val-Glu-Trp-Leu-Arg-Lys-Lys-Leu-Gln-Asp-Val-His-Asn-Phe-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store in the dark, frozen and dessicated
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 0.40 mg/ml in water
- Formula:
- C181H291N55O51S2
