PACAP (6-38)
About this Product
- SKU:
- PA-030
- Additional Names:
- PACAP 6-38, PACAP (6-38), 143748-18-9, FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2|PACAP 6-38, Pituitary adenylate cyclase activating polypeptide (6-38)
- CAS Number:
- 143748-18-9
- Extra Details:
- PACAP (6-38) is a potent and competitive pituitary adenylate cyclase-activating polypeptide receptor (PAC)1 antagonist with an IC50 of 2 nM. PACAP(6-38)] is a potent mast cell degranulator and has an agonistic effect on MrgB3-receptors expressed in oocytes. PACAP (6-38) acts as a functional Cocaine- and amphetamine-regulated transcript peptides (CARTp) antagonist in vivo and blocks its effects on feeding and short term weight gain.
- Immunogen:
- PACAP receptors
- Molecular Weight:
- 4024.8
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Leyton et al (1999) PACAP(6-38) is a PACAP receptor antagonist for breast cancer cells. Breast Cancer Res Treat. <strong>56</strong>(2) 177 doi: 10.1023/a:1006262611290. PMID: 10573110</p><p>Burgos et al (2013) Pituitary Adenylate Cyclase-Activating Polypeptide 6-38 Blocks Cocaine- and Amphetamine-Regulated Transcript Peptide-Induced Hypophagia in Rats. PLoS ONE <strong>8</strong>(8 ) e72347 https://doi.org/10.1371/journal.pone.0072347<br></p><p>Pedersen et al (2019) PACAP-38 and PACAP(6-38) Degranulate Rat Meningeal Mast Cells via the Orphan MrgB3-Receptor. Front. Cellular Neuroscience <strong>13</strong> 114 https://www.frontiersin.org/article/10.3389/fncel.2019.00114 </p>
- Sequence:
- H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 2 mg/ml in water
- Formula:
- C182H300N56O45S
