Pancreatic polypeptide (human)
About this Product
- SKU:
- NY-030
- Additional Names:
- Pancreatic polypeptide (human), 75976-10-2, APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY-NH2, APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY|Pancreatic polypeptide, PP
- CAS Number:
- 75976-10-2
- Extra Details:
- Pancreatic polypeptide (human) is an endogenous high affinity agonist for the human NPY Y4 receptor, with a Ki of 0.056 nM. Pancreatic polypeptide (human) is produced and secreted by PP cells of the pancreas which are primarily located in the Islets of Langerhans and is a member of the family of peptides that includes peptide YY (PYY) and neuropeptide Y (NPY). Pancreatic polypeptide (human) is rapidly released after a meal and in humans remains elevated for 4-6 hours, with the vagus nerve being the major stimulator. Pancreatic polypeptide (human) causes a sustained decrease in both appetite and food intake.
- Immunogen:
- Neuropeptide Y receptors
- Molecular Weight:
- 4181.7
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Bard et al (1995) Cloning and functional expression of a human Y4 subtype receptor for pancreatic polypeptide, neuropeptide Y, and peptide YY. J.Biol.Chem.<strong> 270</strong> 26762 <a href="https://pubmed.ncbi.nlm.nih.gov/7592911/" target="_blank" rel="nofollow">PMID: 7592911</a></p><p>Batterham et al (2003) Pancreatic Polypeptide Reduces Appetite and Food Intake in Humans. J. Clin. Endocrinology Metabolism<strong> 88</strong>(8) 3989 <a href="https://pubmed.ncbi.nlm.nih.gov/12915697/" target="_blank" rel="nofollow">PMID: 12915697</a></p><p>Suzuki et al (2011) The gut hormones in appetite regulation. J Obes. <strong>2011</strong> 528401<a href="https://pubmed.ncbi.nlm.nih.gov/21949903/" target="_blank" rel="nofollow"> PMID: 21949903</a></p>
- Sequence:
- H-Ala-Pro-Leu-Glu-Pro-Val-Tyr-Pro-Gly-Asp-Asn-Ala-Thr-Pro-Glu-Gln-Met-Ala-Gln-Tyr-Ala-Ala-Asp-Leu-Arg-Arg-Tyr-Ile-Asn-Met-Leu-Thr-Arg-Pro-Arg-Tyr-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 0.70 mg/ml in water
- Formula:
- C185H287N53O54S2
