ACTH (1-39) (human)
About this Product
- SKU:
- MC-020
- Additional Names:
- ACTH (1-39) (human), Adrenocorticotropic hormone (1-39), Corticotropin, 12279-41-3, SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF, MC-020, MC 020|Adrenocorticotropic hormone, Corticotropin, ACTH (1-39)
- CAS Number:
- 12279-41-3
- Extra Details:
- ACTH (1-39) (human) is a melanocortin receptor 2 (MC2R) agonist with an EC50 of 57 pM. ACTH (1-39) (human), also known as corticotropin, is a cleavage product from the precursor proopiomelanocortin (POMC) and is a peptide hormone produced in the anterior pituitary gland upon stimulation by corticotropin releasing hormone from the hypothalamus, often in response to stress. ACTH (1-39) (human) is used to treat multiple sclerosis relapses, acting by stimulating adrenal corticosteroid production through the MC2R.
- Immunogen:
- Melanocortin receptors
- Molecular Weight:
- 4541.1
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Kapas et al (1996) Agonist and receptor binding properties of adrenocorticotropin peptides using the cloned mouse adrenocorticotropin receptor expressed in a stably transfected HeLa cell line. Endocrinology <strong>137</strong> 3291 <a href="https://pubmed.ncbi.nlm.nih.gov/8754753/" target="_blank" rel="nofollow">PMID: 8754753</a></p><p>Ghaddhab et al (2017) From Bioinactive ACTH to ACTH Antagonist: The Clinical Perspective. Front Endocrinol (Lausanne) <strong>8</strong> 17 <a href="https://pubmed.ncbi.nlm.nih.gov/28228747/" target="_blank" rel="nofollow">PMID: 28228747</a></p><p>Benjamins et al (2018) Melanocortin receptor subtypes are expressed on cells in the oligodendroglial lineage and signal ACTH protection. J Neurosci Res. <strong>96</strong>(3) 427 <a href="https://pubmed.ncbi.nlm.nih.gov/28877366/" target="_blank">PMID: 28877366</a><br></p>
- Sequence:
- H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 1 mg/ml in water
- Formula:
- C207H308N56O58S
