GIP_HUMAN[22-51]
About this Product
- SKU:
- GL-040
- Additional Names:
- GIP_HUMAN[22-51], GL-040, EKKEGHFSALPSLPVGSHAKVSSPQPRGPR, GIP_HUMAN[22-51]
- Extra Details:
- GIP_HUMAN[22-51] is a potent proatherosclerotic peptide hormone which has a common precursor with glucose-dependent insulinotropic polypeptide (GIP). Chronic infusion of GIP_HUMAN[22-51] into ApoE^'/^' mice accelerates the development of aortic atherosclerotic lesions and it also increases the serum concentrations of many inflammatory and proatherogenic proteins, and induces I K Kappa B-A Alpha degradation and nuclear translocation of NF- K Kappa B in human vascular endothelial cells and macrophages. GIP_HUMAN[22-51 can also be labelled with 5-carboxyfluorescein and stable isotope labelled, please inquire.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 3181.6
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Masaki et al (2021) GIP_HUMAN[22-51] is a new proatherogenic peptide identified by native plasma peptidomics. Sci Rep <strong>11</strong> 14470 <a href="https://www.nature.com/articles/s41598-021-93862-w" target="_blank" rel="nofollow">https://doi.org/10.1038/s41598-021-93862-w</a>
- Sequence:
- H-Glu-Lys-Lys-Glu-Gly-His-Phe-Ser-Ala-Leu-Pro-Ser-Leu-Pro-Val-Gly-Ser-His-Ala-Lys-Val-Ser-Ser-Pro-Gln-Pro-Arg-Gly-Pro-Arg-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water
- Formula:
- C140H226N44O41
