GLP-1 (7-37)
About this Product
- SKU:
- GL-030
- Additional Names:
- GLP-1 (7-37), 106612-94-6, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG|Glucagon like peptide 1 fragment 7-37 (human)
- CAS Number:
- 106612-94-6
- Extra Details:
- GLP-1 (7-37) is an endogenous truncated form of GLP-1 that arises from proglucagon processing in intestinal endocrine L cells, GLP-1 (7-37) acts as a GLP-1 receptor agonist and is an insulinotropic hormone that augments glucose induced insulin secretion. GLP-1 (7-37) and derivatives GLP-1 (9-37) and GLP-1 (28-37) can reduce plaque inflammation and increase phenotypic characteristics of plaque stability in a murine model of atherosclerosis.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 3355.71
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Hargrove et al (1995) Glucose-dependent action of glucagon-like peptide-1 (7-37) in vivo during short- or long-term administration. Metabolism <strong>44</strong>(9) 1231 <a href="https://pubmed.ncbi.nlm.nih.gov/7666800/" target="_blank" rel="nofollow">PMID: 7666800</a></p><p>Vahl (2003) Effects of GLP-1-(7-36)NH2, GLP-1-(7-37), and GLP-1- (9-36)NH2 on intravenous glucose tolerance and glucose-induced insulin secretion in healthy humans. J Clin Endocrinol Metab. <strong>88</strong>(4) 1772 <a href="https://pubmed.ncbi.nlm.nih.gov/12679472/" target="_blank" rel="nofollow">PMID: 12679472</a></p><p>Burgmaier et al (2013) Glucagon-like peptide-1 (GLP-1) and its split products GLP-1(9-37) and GLP-1(28-37) stabilize atherosclerotic lesions in apoe»/» mice. Atherosclerosis <strong>231</strong>(2) 427 <a href="https://pubmed.ncbi.nlm.nih.gov/24267262/" target="_blank" rel="nofollow">PMID: 24267262</a><br></p>
- Sequence:
- H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 1 mg/ml in water
- Formula:
- C151H228N40O47
