RG33
About this Product
- SKU:
- GH-220
- Additional Names:
- RG33, amino acid residues 209-241 of apolipoprotein A1, ApoA-I, lipid metabolism, Ac-PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN-NH2, PALEDLRQGLLPVLESFKVSFLSALEEYTKKLN, GH-220, GH220
- Extra Details:
- RG33 is a peptide corresponding to the two last helical segments, amino acid residues 209-241 of apolipoprotein A1 (ApoA-I), the major protein component of high-density lipoprotein (HDL) particles in plasma. ApoA-I has a specific role in lipid metabolism and enables efflux of molecules by accepting fats from within cells for transport and metabolism elsewhere. In vivo RG33 peptide efficiently solubilizes lipid vesicles, and promotes the efflux of cholesterol from cultured macrophages. In vitro RG33 peptide significantly improves the glucose clearance capacity of insulin resistant mice and provides systemic glucose control in an insulin resistant mouse model.
- Immunogen:
- Protein-protein interactions
- Molecular Weight:
- 3790.41
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- Edmunds et al (2020) A short peptide of the C-terminal class Y helices of apolipoprotein A-I has preserved functions in cholesterol efflux and in vivo metabolic control. Sci. Rep. <strong>10</strong> 18070 https://doi.org/10.1038/s41598-020-75232-0
- Sequence:
- Ac-Pro-Ala-Leu-Glu-Asp-Leu-Arg-Gln-Gly-Leu-Leu-Pro-Val-Leu-Glu-Ser-Phe-Lys-Val-Ser-Phe-Leu-Ser-Ala-Leu-Glu-Glu-Tyr-Thr-Lys-Lys-Leu-Asn-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store desiccated, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- >3 mg/ml in water
- Formula:
- C175H282N42O51
