GIP-1 (3-42) (human)
About this Product
- SKU:
- GH-170
- Additional Names:
- EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, 1802086-25-4, GIP (3-42), GIP receptor, GIPR, GH-170, GH170
- CAS Number:
- 1802086-25-4
- Extra Details:
- GIP (3-42) is produced by cleavage of the first two amino acid residues at the N-terminal (Tyr1-Ala2) from GIP (1-42), also known as GIP, by the serine protease dipeptidyl peptidase IV (DPP-IV). GIP (3-42) itself has no biological activity, but it can compete with GIP for the receptor binding site, resulting in GIP receptor (GIPR) inhibition.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 4749.4
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Deacon et al (2006) GIP-(3-42) does not antagonize insulinotropic effects of GIP at physiological concentrations. Am. J. Physiol. Endocrinol. Metab. <strong>291</strong>(3) E468 doi:10.1152/ajpendo.00577.2005 </p><p>Chenhui Ji et al (2015) Neuroprotective effects of glucose-dependent insulinotropic polypeptide in Alzheimer's disease. Rev. Neurosci.<strong> 27</strong> 1 DOI: https://doi.org/10.1515/revneuro-2015-0021 </p><p>Hansen et al (2016) N-terminally and C-terminally truncated forms of glucose-dependent insulinotropic polypeptide are high-affinity competitive antagonists of the human GIP receptor. Br. J. Pharmacol. <strong>173</strong> 826 doi: 10.1111/bph.13384</p>
- Sequence:
- H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dessicated and frozen in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C214H324N58O63S
