GIP (1-39)
About this Product
- SKU:
- GH-160
- Additional Names:
- YAEGTFISDYSIAMDKIRQQDFVNWLLAQKGKKSDWKHN, 725474-97-5, GIP (1-39), insulinotropic, endogenous, Glucose-dependent Insulinotropic Polypeptide, Gastric Inhibitory Polypeptide, food intake, diabetes, GH-160, GH160
- CAS Number:
- 725474-97-5
- Extra Details:
- GIP (1-39) is a highly potent insulinotropic peptide, it is the endogenous truncated form of the incretin hormone GIP (Glucose-dependent Insulinotropic Polypeptide, or Gastric Inhibitory Polypeptide), a 42-amino acid peptide released by the K cells of the duodenum and jejunum in response to food intake. GIP (1-39) is more potent at stimulating glucose-dependent insulin secretion from rat pancreatic B Beta-cells than GIP and loss of the incretin effect is an early characteristic of type 2 diabetes
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 4633.2
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Xie et al (2004) GIP1-39, a novel Insulinotropic peptide form and aspects on its mechanism of action. Regul.Peptides <strong>121</strong> 107 C. </p><p>Ji et al (2016) Neuroprotective effects of glucose-dependent insulinotropic polypeptide in Alzheimer's disease. Rev. Neurosci. <strong>27</strong>(1) 61 DOI 10.1515/revneuro-2015-0021 </p><p>Hansen et al (2016) N-terminally and C-terminally truncated forms of glucose-dependent insulinotropic polypeptide are high-affinity competitive antagonists of the human GIP receptor. Br. J. Pharmacol. <strong>173</strong> 826</p>
- Sequence:
- H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-Arg-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Ser-Asp-Trp-Lys-His-Asn-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dark, dry and frozen
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble to 10 mg per ml in water
- Formula:
- C210H316N56O61S
