GIP (human)
About this Product
- SKU:
- GH-150
- Additional Names:
- Gastric Inhibitory Polypeptide, Glucose dependent insulinotropic polypeptide|YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ, 100040-31-1, GIP, Gastric Inhibitory Polypeptide, proprotein encoded by the GIP gene, food intake, stimulate insulin release, diabetics , Glucose dependent insulinotropic polypeptide, GH-150, GH150
- CAS Number:
- 100040-31-1
- Extra Details:
- GIP (Gastric Inhibitory Polypeptide) is derived from a 153-amino acid proprotein encoded by the GIP gene and circulates as a biologically active 42-amino acid peptide. GIP is released by the K cells of the duodenum and jejunum in response to food intake and while it is weak inhibitor of gastric acid secretion, its main role is to stimulate insulin release. Type 2 diabetics are not responsive to GIP and have lower levels of GIP secretion after a meal when compared to non-diabetics. In mice, absence of GIP receptors correlates with resistance to obesity.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 4983.6
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Wheeler et al (1995) Functional expression of the rat pancreatic islet glucose-dependent Insotropic polypeptide receptor: ligand binding and intracellular signaling properties. Endocrinol. <strong>136</strong> 4629 </p><p>Meier et al (2002) Gastric inhibitory polypeptide: the neglected incretin revisited. Regul.Peptides <strong>10</strong>7 1 </p><p>Hansen et al (2016) N-terminally and C-terminally truncated forms of glucose-dependent insulinotropic polypeptide are high-affinity competitive antagonists of the human GIP receptor. Br. J. Pharmacol. <strong>173</strong> 826 doi: 10.1111/bph.13384.</p>
- Sequence:
- H-Tyr-Ala-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dessicated, dark and frozen
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C226H338N60O66S
