Peptide YY (3-36) (human)
About this Product
- SKU:
- GH-120
- Additional Names:
- IKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 126339-09-1, PYY (3-36), metabolite, PYY1-36, appetite , Y2 receptor agonist, food intake, weight gain, GH-120, GH120
- CAS Number:
- 126339-09-1
- Extra Details:
- PYY (3-36) is the N-terminal truncated metabolite of PYY1-36 and is released from the gastrointestinal tract postprandially in proportion to the calorie content of a meal. PYY(3-36) reduces appetite and inhibits food intake through action as a Y2 receptor agonist with IC50 values of 0.11 and 1050 nM for inhibition of 125I-PYY binding to Y2 and Y1 receptors respectively. Peptide YY (3-36) can inhibit food intake and reduce weight gain in vivo.
- Immunogen:
- Neuropeptide Y receptors
- Molecular Weight:
- 4049.6
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Batterham et al (2002) Gut hormone PYY3-36 physiologically inhibits food intake. Nature <strong>418</strong> 650 PMID: 12167864 </p><p>Nonaka et al (2003) Characterization of blood-brain barrier permeability to PYY3-36 in the mouse. J.Pharmacol.Exp.Ther.<strong> 306</strong> 948 PMID: 12750431 </p><p>Torang et al (2015) The anorexic hormone Peptide YY3-36 is rapidly metabolized to inactive Peptide YY3-34 in vivo. Physiol. Rep. <strong>3</strong>(7) 2015, e12455, doi:10.14814/phy2.12455</p>
- Sequence:
- H-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, dark and frozen
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C180H279N53O54
