Peptide YY (human)
About this Product
- SKU:
- GH-110
- Additional Names:
- H-YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2, 118997-30-1, Peptide YY, PYY, PYY (1-36), Peptide YY, neuropeptide Y, NPY, food ingestion, gut motility, insulin secretion, obesity, diabetes, GH-110, GH110|PYY, PYY (1-36)
- CAS Number:
- 118997-30-1
- Extra Details:
- Peptide YY, also known as PYY and PYY (1-36) is a 36-amino acid peptide that is synthesized and released from enteroendocrine cells. Peptide YY was initially isolated from porcine intestinal extracts and named peptide YY due to the presence of tyrosine residues at the C- and N-termini. Peptide YY belongs to the family of peptides that includes neuropeptide Y (NPY) and pancreatic polypeptide (PP) and all three peptides mediate their effects via G-protein-coupled receptors. Peptide YY binds to all Y-receptor subtypes with similar affinity. Peptide YY in humans has a role in food ingestion, gut motility and insulin secretion, and also suppresses appetite and has been associated with obesity and type 2 diabetes.
- Immunogen:
- Neuropeptide Y receptors
- Molecular Weight:
- 4049.5
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Tatemoto and Mutt (1980) Isolation of two novel candidate hormones using a chemical method for finding naturally occurring polypeptides. Nature <strong>285</strong>(5764) 417 doi:10.1038/285417a0 </p><p>Karra et al (2009) The role of peptide YY in appetite regulation and obesity. J Physiol. <strong>587</strong>(1) 19 doi:10.1113/jphysiol.2008.164269 </p><p>Holzer et al (2012) Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides <strong>46</strong>(6) 261doi:10.1016/j.npep.2012.08.005</p>
- Sequence:
- H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store desiccated, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C194H295N55O57
