Oxyntomodulin
About this Product
- SKU:
- GH-070
- Additional Names:
- OXM, Glucagon 37|Oxyntomodulin , endogenous, glucagon-like peptide, GLP-1), anorectic, feeding, metabolism , HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA, 62340-29-8, GH-070, GH070
- CAS Number:
- 62340-29-8
- Extra Details:
- Oxyntomodulin is an endogenous glucagon-like peptide from the preproglucagon family that is secreted by intestinal L-cells. Oxyntomodulin binds to and activates the glucagon-like peptide (GLP-1) receptor, with its anorectic effects being blocked by the GLP-1 receptor antagonist exendin (9-39) and absent in GLP-1 receptor knockout mice. Oxyntomodulin modulates feeding and metabolism and inhibits gastric acid secretion.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 4421.86
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Bataille et al (1981) Bioactive enteroglucagon (oxyntomodulin): present knowledge on its chemical structure and its biological activities. Peptides<strong> 2</strong> 41<a href="https://pubmed.ncbi.nlm.nih.gov/6283496/" target="_blank" rel="nofollow"> PMID: 6283496</a></p><p>Jarrousse et al (1985) Oxyntomodulin (glucagon-37) and its C-terminal octapeptide inhibit gastric acid secretion. FEBS Lett. 188(1) <strong>81</strong> <a href="https://pubmed.ncbi.nlm.nih.gov/4018272/" target="_blank" rel="nofollow">PMID: 4018272</a></p>
- Sequence:
- H-His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Lys-Asn-Asn-Ile-Ala-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, dark and frozen
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C192H295N59O60S
