Neuropeptide Y (human, rat)
About this Product
- SKU:
- GH-060
- Additional Names:
- Neuropeptide Y, NPY, endogenous neuropeptide, blood pressure regulation, 90880-35-6, H-YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY-NH2, GH-060, GH060
- CAS Number:
- 90880-35-6
- Extra Details:
- Neuropeptide Y (human, rat) is a widely distributed endogenous neuropeptide which mediates its physiological effects through at least four receptors, Y1, Y2, Y4, and Y5. Neuropeptide Y (human, rat) is one of the most abundant peptides in the central nervous system and is highly conserved throughout evolution. Neuropeptide Y (human, rat) is involved in a range of biochemical processes including appetite control, sexual behaviour and blood pressure regulation.
- Immunogen:
- Neuropeptide Y receptors
- Molecular Weight:
- 4271.7
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Michel et al (1998) XVI. International Union of Pharmacology recommendations for the nomenclature of neuropeptide Y, peptide YY, and pancreatic polypeptide receptors. Pharmacol.Rev. 50 143 PMID: 9549761 </p><p>Morales-Medina et al (2010) A possible role of neuropeptide Y in depression and stress. Brain Res. <strong>1314</strong> 194. doi:10.1016/j.brainres.2009.09.077 </p><p>Holzer et al (2012) Neuropeptide Y, peptide YY and pancreatic polypeptide in the gut-brain axis. Neuropeptides 2012 <strong>46</strong>(6) 261. doi:10.1016/j.npep.2012.08.005</p>
- Sequence:
- H-Tyr-Pro-Ser-Lys-Pro-Asp-Asn-Pro-Gly-Glu-Asp-Ala-Pro-Ala-Glu-Asp-Met-Ala-Arg-Tyr-Tyr-Ser-Ala-Leu-Arg-His-Tyr-Ile-Asn-Leu-Ile-Thr-Arg-Gln-Arg-Tyr-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store in the dark, frozen and desiccated
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C189H285N55O57S
