GLP-1 (7-36) amide (human, rat)
About this Product
- SKU:
- GH-050
- Additional Names:
- H-HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, 107444-51-9, GLP-1 (7-36) amide, insulinotropic, hormone, proglucagon, GLP-1 receptor, antiapoptotic
- CAS Number:
- 107444-51-9
- Extra Details:
- GLP-1 (7-36) amide is a potent insulinotropic incretin peptide hormone produced as a result of proteolytic post-translational modification of proglucagon in L-cells of the lower intestine. GLP-1 (7-36) amide displays high affinity for GLP-1 receptors expressed in rat insulinoma-derived RINm5F cells with a Kd of 204 pM. GLP-1 (7-36) amide stimulates insulin gene transcription and secretion in pancreatic B Beta-cells, displays antiapoptotic effects in hippocampal neurons and reduces food intake in fasted rats following central administration.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 3297.7
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Perfetti and Merkel (2000) Glucagon-like peptide-1: a major regulator of pancreatic β-cell function. Eur.J.Endocrinol. <strong>143</strong> 717 PMID: 11124853 </p><p>Perry et al (2002) Protection and reversal of excitotoxic neuronal damage by glucagon-like peptide-1 and exendin-4. J.Pharmacol.Exp.Ther. <strong>302</strong> 881 PMID: 12183643 </p><p>Marchetti et al (2012) A local glucagon-like peptide 1 (GLP-1) system in human pancreatic islets. Diabetologia <strong>55</strong>(12) 3262 doi:10.1007/s00125-012-2716-9</p>
- Sequence:
- H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and desiccated
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C149H226N40O45
