GLP-1 (1-36) amide
About this Product
- SKU:
- GH-030
- Additional Names:
- GLP-1 (1-36) amide, posttranslational, proglucagon (72-107), H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGR-NH2, 99658-04-5, GH-030, GH030
- CAS Number:
- 99658-04-5
- Extra Details:
- GLP-1 (1-36) amide is the posttranslational product of proteolysis of proglucagon (72-107)
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 4111.5
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Schmidtler et al (1991) GLP-1-(7-36) amide, -(1-37), and -(1-36) amide: potent cAMP-dependent stimuli of rat parietal cell function. Am. J. Phys. Gast. Liver Physiol. <strong>260</strong>(6) G940 <a href="https://pubmed.ncbi.nlm.nih.gov/1711782/" target="_blank">PMID: 1711782</a></p><p>Koole et al (2013) Recent advances in understanding GLP-1R (glucagon-like peptide-1 receptor) function. Biochem. Soc. Trans. <strong>41</strong>(1) 172 <a href="https://pubmed.ncbi.nlm.nih.gov/23356279/" target="_blank">PMID: 23356279</a></p>
- Sequence:
- H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store desiccated, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C184H273N51O57
