GLP-1 (1-37) (human, rat)
About this Product
- SKU:
- GH-020
- Additional Names:
- GLP-1 (1-37)|GLP-1 (1-37), pancreatic hormone, proteolysis of proglucagon, food intake, glucose metabolism, insulin release, glucagon secretion, insulinotropic, GLP-1, diabetes. GLP-1 (1-37) , H-HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG-OH, HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG, 87805-34-3, GH-020, GH020
- CAS Number:
- 87805-34-3
- Extra Details:
- GLP-1 (1-37) is a pancreatic hormone resulting from post-translational proteolysis of proglucagon. GLP-1(1-37) does not affect food intake in rats and does not enhance pancreatic insulin. It is secreted by the small intestine in response to nutrient ingestion with wide-ranging effects on glucose metabolism, including stimulation of insulin release, inhibition of glucagon secretion, reduction of gastric emptying and satiety. The insulinotropic actions of GLP-1 depend on ambient glucose concentrations, making it highly relevant in type 2 diabetes. GLP-1 (1-37) also has an important role in the cardiovascular system.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 4169.5
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Suzuki et al (2003) Glucagon-like peptide 1 (1-37) converts intestinal epithelial cells into Ins-producing cells. Proc.Natl.Acad.Sci.USA <strong>100</strong> 5034</p><p>Grieve et al (2009) Emerging cardiovascular actions of the incretin hormone glucagon-like peptide-1: potential therapeutic benefits beyond glycaemic control? Br. J. Pharmacol. <strong>15</strong>7(8), 1340 https://doi.org/10.1111/j.1476-5381.2009.00376.x</p><p>Zhao et al (2012) Glucagon-like peptide-1(1-37) can enhance blood glucose homeostasis in mice. Reg. Pept. <strong>178</strong>(1-3) 1</p>
- Sequence:
- H-His-Asp-Glu-Phe-Glu-Arg-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store dry, frozen and desiccated
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C186H275N51O59
