Exendin-4 (9-39) amide
About this Product
- SKU:
- GH-010
- Additional Names:
- Exendin (9-39) amide, glucagon-like peptide-1, GLP-1 receptor, antagonist, DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, H-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-010, GH010, Avexitide, 9-39-Exendin 4 (Heloderma suspectum);|Exendin(9-39) amide, Avexitide, 9-39-Exendin 4 (Heloderma suspectum)
- CAS Number:
- 133514-43-9
- Extra Details:
- Exendin-4 (9-39) amide is a potent and selective glucagon-like peptide-1 (GLP-1) receptor antagonist with a Kd of 1.7 nM at cloned human GLP-1 receptors. Exendin-4 (9-39) amide inhibits cAMP production and insulin release caused by GLP-1 (7-36) and exendin-4. Exendin-4 (9-39) amide also blocks the inhibitory effect of GLP-1 on food intake in rats.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 3369.8 Da
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Raufman et al (1991) Exendin-3, a novel peptide from the Heloderma horridum venom, interacts with vasoactive intestinal peptide receptors and a newly described receptor on dispersed acini from guinea pig pancreas. J.Biol.Chem. <strong>266</strong> 2897 <a href="https://pubmed.ncbi.nlm.nih.gov/1704369/" target="_blank" rel="nofollow">PMID: 1704369</a></p><p>Goke et al (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of Ins-Secr.g β-cells. J.Biol.Chem. <strong>268</strong> 19650 <a href="https://pubmed.ncbi.nlm.nih.gov/8396143/" target="_blank" rel="nofollow">PMID: 8396143</a></p><p>Calabria et al (2012) GLP-1 receptor antagonist exendin-(9-39) elevates fasting blood glucose levels in congenital hyperinsulinism owing to inactivating mutations in the ATP-sensitive K+ channel. Diabetes <strong>61</strong>(10) 2585 <a href="https://pubmed.ncbi.nlm.nih.gov/22855730/" target="_blank" rel="nofollow">doi:10.2337/db12-0166</a></p>
- Sequence:
- H-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store desiccated, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid and physiological buffers
- Formula:
- C149H234N40O47S
