Exendin-4 (3-39) amide
About this Product
- SKU:
- GH-008
- Additional Names:
- Exendin-4 (3-39) amide, glucagon-like peptide 1, GLP-1, antagonist, 196109-31-6, H-EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, EGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-008, GH008 .
- CAS Number:
- 196109-31-6
- Extra Details:
- Exendin-4 (3-39) amide is a potent glucagon-like peptide 1 (GLP-1) receptor antagonist. GLP-1 is a G protein-coupled receptor (GPCR) that shares sequence identity with other Family B receptors such as those for secretin, glucagon, and vasoactive intestinal peptide. .
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 3992.4
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Lopez de Maturana et al. J. Biol. Chem. The Isolated N-terminal Domain of the Glucagon-like Peptide-1 (GLP-1) Receptor Binds Exendin Peptides with Much Higher Affinity than GLP-1(2003)<strong> 278</strong> 10195 doi: 10.1074/jbc.M212147200 </p><p>Liao et al (2015) In Vitro Metabolic Stability of Exendin-4: Pharmacokinetics and Identification of Cleavage Products. PLoS ONE <strong>10</strong>(2) e0116805.https://doi.org/10.1371/journal.pone.0116805<br></p>
- Sequence:
- H-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store desiccated, frozen and in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in dilute acid
- Formula:
- C176H272N46O58S
