Exendin-4
About this Product
- SKU:
- GH-001
- Additional Names:
- Exenatide|Exendin-4, exenatide, glucagon-like peptide 1, GLP-1, Heloderma, suspectum, diabetes mellitus, 141758-74-9, HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2, GH-001, GH001
- CAS Number:
- 141758-74-9
- Extra Details:
- Exendin-4, also known as exenatide, is a high affinity glucagon-like peptide 1 (GLP-1) receptor agonist originally isolated from Heloderma suspectum venom. It has 50% amino acid homology to GLP-1 and a longer half-life in vivo, and potentiates glucose-induced insulin secretion in isolated rat islets. Exenatide is used to treat type 2 diabetes mellitus as an add-on treatment and has also been evaluated for the treatment of Parkinson's disease.
- Immunogen:
- Glucagon and related receptors
- Molecular Weight:
- 4186.6
- Physical State:
- Freeze dried solid
- Purity:
- >95%
- References:
- <p>Eng et al (1992) Isolation and characterization of exendin-4, an exendin-3 analogue, from Heloderma suspectum venom. J.Biol.Chem. <strong>267</strong> 7402 <a href="https://pubmed.ncbi.nlm.nih.gov/1313797/" target="_blank" rel="nofollow">PMID: 1313797</a></p><p>Goke et al (1993) Exendin-4 is a high potency agonist and truncated exendin-(9-39)-amide an antagonist at the glucagon-like peptide 1-(7-36)-amide receptor of Ins-Secr.g β-cells. J.Biol.Chem. <strong>268</strong> 19650 <a href="https://pubmed.ncbi.nlm.nih.gov/8396143/" target="_blank" rel="nofollow">PMID: 8396143</a></p><p>Varin et al (2016) Inhibition of the MAP3 kinase Tpl2 protects rodent and human β-cells from apoptosis and dysfunction induced by cytokines and enhances anti-inflammatory actions of exendin-4. Cell Death Dis. <strong>7</strong> e2065<a href="https://www.nature.com/articles/cddis2015399" target="_blank" rel="nofollow"> https://doi.org/10.1038/cddis.2015.399</a></p>
- Sequence:
- H-His-Gly-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Leu-Ser-Lys-Gln-Met-Glu-Glu-Glu-Ala-Val-Arg-Leu-Phe-Ile-Glu-Trp-Leu-Lys-Asn-Gly-Gly-Pro-Ser-Ser-Gly-Ala-Pro-Pro-Pro-Ser-Asn-His-NH2
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- Store desiccated at -20°C in the dark
- Size:
- 1 mg
- Supplier:
- Isca Biochemicals
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Peptides
- Solubility:
- Soluble in water (10mg/mL), PBS, dilute acid and DMSO.
- Formula:
- C184H282N50O60S
